PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G253000.1
Common NameB456_010G253000, CPC, LOC105773171
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 80aa    MW: 9142.88 Da    PI: 4.1393
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G253000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.2e-123073146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +++++++E+ l+++ +++ G + W++Ia +++ gRt++++ ++w++
  Gorai.010G253000.1 30 KLKFSEDEETLIIRMFNLVGER-WALIAGRIP-GRTAEEIEEYWNT 73
                        689*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.8362579IPR017930Myb domain
SMARTSM007173.6E-102977IPR001005SANT/Myb domain
PfamPF002492.1E-113173IPR001005SANT/Myb domain
CDDcd001673.89E-93273No hitNo description
SuperFamilySSF466891.95E-93275IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-143274IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MADSQHSSSG KTYVNSQDFS SEEETNEESK LKFSEDEETL IIRMFNLVGE RWALIAGRIP  60
GRTAEEIEEY WNTRYSTSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4029301e-131FJ402930.1 Gossypium hirsutum cultivar TM-1 CAPRICE (CPC) mRNA, complete cds.
GenBankFJ4029321e-131FJ402932.1 Gossypium hirsutum cultivar MD17 CAPRICE (CPC) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450325.19e-52PREDICTED: MYB-like transcription factor ETC1
SwissprotO220598e-17CPC_ARATH; Transcription factor CPC
TrEMBLB7TX251e-51B7TX25_G
TrEMBLB7TX331e-51B7TX33_G
TrEMBLB7TX341e-51B7TX34_G
STRINGPOPTR_0011s00390.18e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.14e-18MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]